PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02078.1.g00020.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 813aa    MW: 88501 Da    PI: 8.3845
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02078.1.g00020.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.7e-183891356
                                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                  k+++++ eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  Zpz_sc02078.1.g00020.1.am.mk 38 KKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 91
                                  456899***********************************************9 PP

2HD-ZIP_I/II130.37.5e-4237129193
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   ekkrrls eqv++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal+ ++++L+
  Zpz_sc02078.1.g00020.1.am.mk  37 EKKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDALRLDHDALR 117
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreelke 93 
                                   +++++L +e+ke
  Zpz_sc02078.1.g00020.1.am.mk 118 RDKDALLAEIKE 129
                                   *******99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-183295IPR009057Homeodomain-like
PROSITE profilePS5007117.2973393IPR001356Homeobox domain
SMARTSM003892.1E-183697IPR001356Homeobox domain
PfamPF000461.4E-153891IPR001356Homeobox domain
CDDcd000862.99E-163894No hitNo description
Gene3DG3DSA:1.10.10.606.5E-1940100IPR009057Homeodomain-like
PRINTSPR000316.1E-56473IPR000047Helix-turn-helix motif
PROSITE patternPS0002706891IPR017970Homeobox, conserved site
PRINTSPR000316.1E-57389IPR000047Helix-turn-helix motif
PfamPF021831.8E-1693134IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 813 aa     Download sequence    Send to blast
MEAVLLPYGD DGYGGVGMEA EGDAEEEMMA CGGGGGEKKR RLSVEQVRAL ERSFEVENKL  60
EPERKARLAR DLGLQPRQVA VWFQNRRARW KTKQLERDYA ALRHSYDALR LDHDALRRDK  120
DALLAEIKEL KAKLGDEETT ASFTSVKAEL AAFDEPPTAG TGSSESDSSA VLNDADPAGA  180
TPPTELPPAP EIQQGTLLGS ATAAVAGTAA ARQAELLFHG SFLKVEEDDT GFLDDDEPCG  240
GFFAVEQPPP MTVKIEECRG RAEQVNGHPT GRCPWGRGHV KRRHWPPIDV PGLPVTPMPR  300
RERAWPCARV VASAKAWWLL WSIRASSALY LLVVLRHCRH VVEIIPVPLF HAVVVVLLIV  360
ICGCRNEMNA WITGLKLSPF FSTSPSGDHA RITLTKAQPM DPTLTSSQGT ETINAAAIPS  420
FARKQEEDWS LEVAAPTVQE ARCNGGGDCT ASDDHFPSGP AWVARVNSQP HATSSSRTPL  480
HRVAARFEFE GQERFNECCG SGRALVQGPW SARGSHRPAQ ARVKLSSAPS NPFPPCTRGQ  540
PASRVRLLRM WATRDSTIRA ARARRQPEPG TRDRSGTLHS RMAFVPLDRV NNDWRVAQSA  600
CTGIEQCAPT TTDMEPRRME SMERTRIKSQ EHENEKKRSG RVVSAPLPKD SKHGVTIATC  660
DRGPGQVVER FVVKGNGSGK AAAPVATSSA NHECIPISPL PIRGGQGHGQ LRATVTSTVL  720
LCCRMIGDER GSGRCHLADL ETQPDPTRRR MMASVRHATN AAAYSVAGSR RRGEGKKAVA  780
RDRPVDSAVD SESDATIVQT VVREIPGGAK HVE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16268ERKARLA
28593RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.15e-37homeobox protein 16